PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P03610_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 144aa    MW: 16495.9 Da    PI: 8.6542
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P03610_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS186.22.2e-571143230373
                   GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWre 317
                            +vk+lsP+v ++veqe+++n++sFl+rf+e+leyysa+++s++a+lpr+s+eri+vE+++l+++ivn++aceg+er+erhe l+kWr+
  GSMUA_Achr8P03610_001   1 MVKGLSPRVTTLVEQESNTNTTSFLTRFMETLEYYSAMLESIDATLPRDSKERINVEQHCLAKDIVNIIACEGKERVERHELLGKWRS 88 
                            69************************************************************************************** PP

                   GRAS 318 rleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                            rl++aGFkp+pls+++++ +k+ll  ++ d y++ e++g+++lgWk+r+L+s+SaW
  GSMUA_Achr8P03610_001  89 RLSMAGFKPYPLSSYVNSVIKTLLGYYS-DKYTLVEKDGAMLLGWKNRNLISASAW 143
                            ************************9999.55************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035147.7E-551143IPR005202Transcription factor GRAS
PROSITE profilePS5098528.2871125IPR005202Transcription factor GRAS
Gene3DG3DSA:1.20.1250.100.0011163IPR012351Four-helical cytokine, core
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MVKGLSPRVT TLVEQESNTN TTSFLTRFME TLEYYSAMLE SIDATLPRDS KERINVEQHC  60
LAKDIVNIIA CEGKERVERH ELLGKWRSRL SMAGFKPYPL SSYVNSVIKT LLGYYSDKYT  120
LVEKDGAMLL GWKNRNLISA SAWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-251144228375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412448.11e-100PREDICTED: chitin-inducible gibberellin-responsive protein 1-like
SwissprotQ69VG14e-86CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLM0TMB31e-105M0TMB3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P03610_0011e-104(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5149922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.23e-76GRAS family protein